PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G1985
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 352aa    MW: 37194 Da    PI: 7.731
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G1985genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP70.92.4e-2290137148
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                  +CqvegC++dls+ak y++rhkvC +hsk+++v+v+gleqrfCqqCsr
  Gh_D04G1985  90 RCQVEGCKVDLSDAKAYYSRHKVCCMHSKSSKVIVAGLEQRFCQQCSR 137
                  6**********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-2387137IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.2388165IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-2289137IPR004333Transcription factor, SBP-box
PfamPF031101.9E-1691137IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MEMGSSSLTE SGGSSTNSSA ESLNGLKFGK KIYFEDTAAV AATAGGDGKS VGDGANIGTP  60
SKSGPGSSSL SGSGRKARVD GMAQGVLPPR CQVEGCKVDL SDAKAYYSRH KVCCMHSKSS  120
KVIVAGLEQR FCQQCSRSAL QIPPKNGSRG GSFIVDFSAY PRLPGRDAWP AARSLECITG  180
NRNTATGSSF SHPWQNNSNK PPHDHFLQGS PCGTSFSSTG ISPGECFTGS GDSSCALSLL  240
SNQPWGSRNQ ALNFSVNGVI STEGSSAAQP TTPHGAVVNP YSNASLDFNG SDTVRSSHKM  300
LPHLDLGQIP DPVNRQFSSD LELSQQSWRS YMEHEQSRAA YDDSMQHIHW TL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A2e-1491137652squamosa promoter-binding protein-like 12
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.181440.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223123e-62KJ622312.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012484407.10.0PREDICTED: squamosa promoter-binding-like protein 9 isoform X2
TrEMBLA0A0D2RRB30.0A0A0D2RRB3_G
STRINGVIT_08s0007g06270.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21442775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.11e-37squamosa promoter binding protein-like 9